ULK1 Antikörper

Produktnummer ABIN7882638

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ULK1 in WB, FACS und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für ULK1 Antikörper (ABIN7882638)

Target: ULK1 (Unc-51 Like Kinase 1 (ULK1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ULK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-ULK1 Antikörper

Verwendungszweck: ULK1 Antibody

Sequenz: EETLMEQEHT EILRGLRFTL LFVQHVLEIA ALK

Aufreinigung: Affinity purified

Immunogen: Amino acids EETLMEQEHTEILRGLRFTLLFVQHVLEIAALK from the human protein were used as the immunogen for the ULK1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ULK1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the ULK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu ULK1

Target: ULK1 (Unc-51 Like Kinase 1 (ULK1))

Andere Bezeichnung: ULK1

Hintergrund: ULK1 is an enzyme that in humans is encoded by the ULK1 gene. It is mapped to 12q24.33. Unc-51 like autophagy activating kinase (ULK1/2) are two similar isoforms of an enzyme that in humans are encoded by the ULK1/2 genes. It is specifically a kinase that is involved with autophagy, particularly in response to amino acid withdrawal. Not many studies have been done comparing the two isoforms, but some differences have been recorded.

UniProt: O75385

Pathways: Regulation of Cell Size, Autophagie