MAVS Antikörper (C-Term)

Produktnummer ABIN635036

Produktdetails anti-MAVS Antikörper

Target: MAVS (Mitochondrial Antiviral Signaling Protein (MAVS))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAVS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: VISA antibody was raised against the C terminal of VISA

Aufreinigung: Affinity purified

Immunogen: VISA antibody was raised using the C terminal of VISA corresponding to a region with amino acids VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VISA Blocking Peptide, catalog no. 33R-9412, is also available for use as a blocking control in assays to test for specificity of this VISA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VISA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAVS

Target: MAVS (Mitochondrial Antiviral Signaling Protein (MAVS))

Andere Bezeichnung: VISA (MAVS Produkte)

Synonyme: CARDIF antikoerper, IPS-1 antikoerper, IPS1 antikoerper, VISA antikoerper, D430028G21Rik antikoerper, Visa antikoerper, cardif antikoerper, wu:fj20d04 antikoerper, zgc:158392 antikoerper, mitochondrial antiviral signaling protein antikoerper, MAVS antikoerper, Mavs antikoerper, mavs antikoerper

Hintergrund: Double-stranded RNA viruses are recognised in a cell type-dependent manner by the transmembrane receptor TLR3 or by the cytoplasmic RNA helicases MDA5 and RIGI (ROBO3). These interactions initiate signaling pathways that differ in their initial steps but converge in the activation of the protein kinases IKKA (CHUK) and IKKB (IKBKB), which activate NFKB, or TBK1 and IKKE (IKBKE), which activate IRF3. Activated IRF3 and NFKB induce transcription of IFNB (IFNB1). For the TLR3 pathway, the intermediary molecule before the pathways converge is the cytoplasmic protein TRIF (TICAM1). For RIGI, the intermediary protein is mitochondria-bound VISA.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Inositol Metabolic Process, Hepatitis C