Patched 1 Antikörper (PTCH1)

Details for Product anti-PTCH1 Antibody No. ABIN634927
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
95
48
12
3
3
3
3
2
2
2
2
1
1
Wirt
Kaninchen
61
29
22
Klonalität
Polyklonal
Konjugat
Dieser Patched 1 Antikörper ist unkonjugiert
5
4
4
3
3
3
1
1
1
1
1
1
Applikation
Western Blotting (WB)
94
57
32
15
9
6
3
3
3
2
1
1
Optionen
Immunogen PTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM
Reinigung Affinity purified
Antigen
Andere Bezeichnung PTCH1 (PTCH1 Antibody Abstract)
Hintergrund PTCH1 is a member of the patched gene family. The protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. It functions as a tumor suppressor. Mutations of its gene have been associated with nevoid basal cell carcinoma syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly.
Molekulargewicht 37 kDa (MW of target protein)
Pathways Hedgehog Signalweg, Carbohydrate Homeostasis, Tube Formation
Applikations-hinweise WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PTCH1 Blocking Peptide, catalog no. 33R-9121, is also available for use as a blocking control in assays to test for specificity of this PTCH1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTCH1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.