AIF Antikörper (C-Term)
-
- Target Alle AIF (AIFM1) Antikörper anzeigen
- AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AIF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PDCD8 antibody was raised against the C terminal Of Pdcd8
- Aufreinigung
- Affinity purified
- Immunogen
- PDCD8 antibody was raised using the C terminal Of Pdcd8 corresponding to a region with amino acids VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST
- Top Product
- Discover our top product AIFM1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PDCD8 Blocking Peptide, catalog no. 33R-9480, is also available for use as a blocking control in assays to test for specificity of this PDCD8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDCD8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))
- Andere Bezeichnung
- PDCD8 (AIFM1 Produkte)
- Synonyme
- AIF antikoerper, CMTX4 antikoerper, COWCK antikoerper, COXPD6 antikoerper, PDCD8 antikoerper, CG7263 antikoerper, DmAIF antikoerper, Dmel\\CG7263 antikoerper, GB16024 antikoerper, DDBDRAFT_0187853 antikoerper, DDBDRAFT_0191137 antikoerper, DDB_0187853 antikoerper, DDB_0191137 antikoerper, aif antikoerper, pdcd8 antikoerper, AIFM1 antikoerper, PCD8 antikoerper, AIFsh2 antikoerper, Hq antikoerper, Pdcd8 antikoerper, mAIF antikoerper, Aif antikoerper, zgc:91994 antikoerper, apoptosis inducing factor mitochondria associated 1 antikoerper, allograft inflammatory factor 1 antikoerper, Apoptosis inducing factor antikoerper, apoptosis-inducing factor 1, mitochondrial antikoerper, apoptosis inducing factor antikoerper, apoptosis inducing factor, mitochondria associated 1 antikoerper, apoptosis-inducing factor, mitochondrion-associated, 1 antikoerper, apoptosis-inducing factor, mitochondrion-associated 1 antikoerper, AIFM1 antikoerper, AIF1 antikoerper, AIF antikoerper, LOC412212 antikoerper, aif antikoerper, aifm1 antikoerper, Aifm1 antikoerper
- Hintergrund
- AIFM1 (PDCD8) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, AIFM1 induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, Warburg Effekt
-