AIF Antikörper (C-Term)

Produktnummer ABIN3043779

Produktdetails anti-AIF Antikörper

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Bindungsspezifität: AA 582-613, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AIF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC)

Verwendungszweck: Rabbit IgG polyclonal antibody for Apoptosis-inducing factor 1, mitochondrial(AIFM1) detection. Tested with WB, IHC-P, ICC in Human,Mouse,Rat.

Sequenz: FNRMPIARKI IKDGEQHEDL NEVAKLFNIH ED

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Apoptosis-inducing factor 1, mitochondrial(AIFM1) detection. Tested with WB, IHC-P, ICC in Human,Mouse,Rat.
Gene Name: apoptosis-inducing factor, mitochondrion-associated, 1
Protein Name: Apoptosis-inducing factor 1, mitochondrial

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat, The detection limit for AIF is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ICC: Concentration: 0.5-1 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P) and ICC.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-AIF Antikörper (ABIN3043779)

Jin, Duan, Xu, Ge, Li, Qiu, Song, Cao, Wang: "Mechanism of apoptosis induction in human hepatocellular carcinoma cells following treatment with a gecko peptides mixture." in: Biomedical reports, Vol. 5, Issue 1, pp. 73-78, (2016) (PubMed).

Yang, Zhang, Wu, Shi, Xue, Li, Chen, Zhu, Wei, He, Liu: "Wnt5a Increases Properties of Lung Cancer Stem Cells and Resistance to Cisplatin through Activation of Wnt5a/PKC Signaling Pathway." in: Stem cells international, Vol. 2016, pp. 1690896, (2016) (PubMed).

Details zu AIF

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Andere Bezeichnung: AIFM1 (AIFM1 Produkte)

Synonyme: AIF antikoerper, CMTX4 antikoerper, COWCK antikoerper, COXPD6 antikoerper, PDCD8 antikoerper, CG7263 antikoerper, DmAIF antikoerper, Dmel\\CG7263 antikoerper, GB16024 antikoerper, DDBDRAFT_0187853 antikoerper, DDBDRAFT_0191137 antikoerper, DDB_0187853 antikoerper, DDB_0191137 antikoerper, aif antikoerper, pdcd8 antikoerper, AIFM1 antikoerper, PCD8 antikoerper, AIFsh2 antikoerper, Hq antikoerper, Pdcd8 antikoerper, mAIF antikoerper, Aif antikoerper, zgc:91994 antikoerper, apoptosis inducing factor mitochondria associated 1 antikoerper, allograft inflammatory factor 1 antikoerper, Apoptosis inducing factor antikoerper, apoptosis-inducing factor 1, mitochondrial antikoerper, apoptosis inducing factor antikoerper, apoptosis inducing factor, mitochondria associated 1 antikoerper, apoptosis-inducing factor, mitochondrion-associated, 1 antikoerper, apoptosis-inducing factor, mitochondrion-associated 1 antikoerper, AIFM1 antikoerper, AIF1 antikoerper, AIF antikoerper, LOC412212 antikoerper, aif antikoerper, aifm1 antikoerper, Aifm1 antikoerper

Hintergrund: Apoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.

Synonyms: AIFM1 antibody|AIFM1_HUMAN antibody|Apoptosis inducing factor 1, mitochondrial antibody|Apoptosis inducing factor antibody|Apoptosis inducing factor, mitochondrion associated, 1 antibody|Apoptosis-inducing factor 1 antibody|CMTX4 antibody|COXPD6 antibody|Harlequin antibody|Hq antibody|mAIF antibody|MGC111425 antibody|MGC5706 antibody|mitochondrial antibody|Neuropathy, axonal motor-sensory, with deafness and mental retardation antibody|neuropathy, axonal, motor-sensory with deafness and mental retardation (Cowchock syndrome) antibody|PDCD 8 antibody|PDCD8 antibody|Programmed cell death 8 (apoptosis inducing factor) antibody|Programmed cell death 8 antibody|Programmed cell death 8 isoform 1 antibody|Programmed cell death 8 isoform 2 antibody|Programmed cell death 8 isoform 3 antibody|Programmed cell death protein 8 antibody|Programmed cell death protein 8 mitochondrial antibody|Programmed cell death protein 8 mitochondrial precursor antibody|Striatal apoptosis inducing factor antibody

Gen-ID: 9131

UniProt: O95831

Pathways: Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, Warburg Effekt