CD40 Antikörper (N-Term)

Produktnummer ABIN634498

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CD40 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für CD40 Antikörper (N-Term) (ABIN634498)

Target: CD40

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CD40 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CD40 Antikörper

Bindungsspezifität: N-Term

Spezifität: CD40 antibody was raised against the N terminal of CD40

Aufreinigung: Affinity purified

Immunogen: CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CD40 Blocking Peptide, (ABIN5612754), is also available for use as a blocking control in assays to test for specificity of this CD40 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CD40

Target: CD40

Andere Bezeichnung: CD40

Hintergrund: CD40 is the receptor for TNFSF5/CD40LG. Defects in CD40 are the cause of hyper-IgM immunodeficiency type 3 (HIGM3).

Molekulargewicht: 20 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg, Cellular Response to Molecule of Bacterial Origin, M Phase, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints