RPS6KB1 Antikörper (N-Term)
-
- Target Alle RPS6KB1 Antikörper anzeigen
- RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPS6KB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPS6 KB1 antibody was raised against the N terminal of RPS6 B1
- Aufreinigung
- Affinity purified
- Immunogen
- RPS6 KB1 antibody was raised using the N terminal of RPS6 B1 corresponding to a region with amino acids MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL
- Top Product
- Discover our top product RPS6KB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPS6KB1 Blocking Peptide, catalog no. 33R-6382, is also available for use as a blocking control in assays to test for specificity of this RPS6KB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 B1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))
- Andere Bezeichnung
- RPS6KB1 (RPS6KB1 Produkte)
- Synonyme
- PS6K antikoerper, S6K antikoerper, S6K-beta-1 antikoerper, S6K1 antikoerper, STK14A antikoerper, p70 S6KA antikoerper, p70(S6K)-alpha antikoerper, p70-S6K antikoerper, p70-alpha antikoerper, 10539 antikoerper, 7084 antikoerper, CG10539 antikoerper, DS6K antikoerper, Dmel\\CG10539 antikoerper, Dp70S6k antikoerper, Dp70[s6k] antikoerper, Dp70s6k antikoerper, S6k antikoerper, dS6K antikoerper, dS6k antikoerper, dp70[S6k] antikoerper, dp70s6k antikoerper, dps6k antikoerper, ds6k antikoerper, fs(3)07084 antikoerper, l(3)07084 antikoerper, p70 S6K antikoerper, p70/S6K antikoerper, p70S6K antikoerper, p70[S6 kinase] antikoerper, p70[S6K] antikoerper, p70[S6k] antikoerper, p70[S6kinase] antikoerper, p70s6K antikoerper, s6k antikoerper, s6k11 antikoerper, 2610318I15Rik antikoerper, 4732464A07Rik antikoerper, 70kDa antikoerper, AA959758 antikoerper, AI256796 antikoerper, AI314060 antikoerper, p70/85s6k antikoerper, p70s6k antikoerper, p70s6k-A antikoerper, p70-s6k antikoerper, ps6k antikoerper, rps6kb1 antikoerper, rps6kb1-A antikoerper, s6K1 antikoerper, stk14a antikoerper, fc51h01 antikoerper, wu:fc51h01 antikoerper, zgc:55713 antikoerper, ribosomal protein S6 kinase B1 antikoerper, Ribosomal protein S6 kinase antikoerper, ribosomal protein S6 kinase, polypeptide 1 antikoerper, ribosomal protein S6 kinase B1 L homeolog antikoerper, ribosomal protein S6 kinase B1 S homeolog antikoerper, ribosomal protein S6 kinase b, polypeptide 1b antikoerper, RPS6KB1 antikoerper, S6k antikoerper, Rps6kb1 antikoerper, rps6kb1.L antikoerper, rps6kb1.S antikoerper, rps6kb1b antikoerper
- Hintergrund
- This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein.
- Molekulargewicht
- 59 kDa (MW of target protein)
- Pathways
- PI3K-Akt Signalweg, RTK Signalweg, AMPK Signaling, Regulation of Cell Size, Skeletal Muscle Fiber Development, Feeding Behaviour, G-protein mediated Events, Smooth Muscle Cell Migration, Interaction of EGFR with phospholipase C-gamma, Warburg Effekt
-