RPS6KB1 Antikörper (N-Term)

Produktnummer ABIN632265

Dieses Anti-RPS6KB1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RPS6KB1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für RPS6KB1 Antikörper (N-Term) (ABIN632265)

Target: RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS6KB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPS6KB1 Antikörper

Bindungsspezifität: N-Term

Spezifität: RPS6 KB1 antibody was raised against the N terminal of RPS6 B1

Aufreinigung: Affinity purified

Immunogen: RPS6 KB1 antibody was raised using the N terminal of RPS6 B1 corresponding to a region with amino acids MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS6KB1 Blocking Peptide, (ABIN5615952), is also available for use as a blocking control in assays to test for specificity of this RPS6KB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 B1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS6KB1

Target: RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))

Andere Bezeichnung: RPS6KB1

Hintergrund: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: PI3K-Akt Signalweg, RTK Signalweg, AMPK Signaling, Regulation of Cell Size, Skeletal Muscle Fiber Development, Feeding Behaviour, G-protein mediated Events, Smooth Muscle Cell Migration, Interaction of EGFR with phospholipase C-gamma, Warburg Effekt