NLRP1 Antikörper (N-Term)

Produktnummer ABIN631304

Produktdetails anti-NLRP1 Antikörper

Target: NLRP1 (NLR Family, Pyrin Domain Containing 1 (NLRP1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NLRP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NLRP1 antibody was raised against the N terminal of NLRP1

Aufreinigung: Affinity purified

Immunogen: NLRP1 antibody was raised using the N terminal of NLRP1 corresponding to a region with amino acids DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NLRP1 Blocking Peptide, catalog no. 33R-2204, is also available for use as a blocking control in assays to test for specificity of this NLRP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NLRP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NLRP1

Target: NLRP1 (NLR Family, Pyrin Domain Containing 1 (NLRP1))

Andere Bezeichnung: NLRP1 (NLRP1 Produkte)

Synonyme: CARD7 antikoerper, CIDED antikoerper, CLR17.1 antikoerper, DEFCAP antikoerper, DEFCAP-L/S antikoerper, NAC antikoerper, NALP1 antikoerper, PP1044 antikoerper, SLEV1 antikoerper, VAMAS1 antikoerper, NLR family pyrin domain containing 1 antikoerper, NLRP1 antikoerper, Nlrp1 antikoerper

Hintergrund: This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death.

Molekulargewicht: 155 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity, Inflammasome