MAP2K3 Antikörper (C-Term)

Produktnummer ABIN631258

Produktdetails anti-MAP2K3 Antikörper

Target: MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAP2K3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAP2 K3 antibody was raised against the C terminal of MAP2 3

Aufreinigung: Affinity purified

Immunogen: MAP2 K3 antibody was raised using the C terminal of MAP2 3 corresponding to a region with amino acids EEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAP2K3 Blocking Peptide, catalog no. 33R-2380, is also available for use as a blocking control in assays to test for specificity of this MAP2K3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAP2K3

Target: MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3))

Andere Bezeichnung: MAP2K3 (MAP2K3 Produkte)

Synonyme: MAPKK3 antikoerper, MEK3 antikoerper, MKK3 antikoerper, PRKMK3 antikoerper, SAPKK-2 antikoerper, SAPKK2 antikoerper, AW212142 antikoerper, Prkmk3 antikoerper, mMKK3b antikoerper, Mkk3 antikoerper, mitogen-activated protein kinase kinase 3 antikoerper, mitogen activated protein kinase kinase 3 antikoerper, MAP kinase activator XMEK3 antikoerper, MAP2K3 antikoerper, Map2k3 antikoerper, map2k3 antikoerper

Hintergrund: MAP2K3 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: MAPK Signalweg, TLR Signalweg, Activation of Innate immune Response, Toll-Like Receptors Cascades, Autophagie, Signaling Events mediated by VEGFR1 and VEGFR2