AMACR Antikörper (Middle Region)

Produktnummer ABIN4886454

Produktdetails anti-AMACR Antikörper

Target: AMACR (alpha-Methylacyl-CoA Racemase (AMACR))

Bindungsspezifität: AA 208-246, Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AMACR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Alpha-methylacyl-CoA racemase(AMACR) detection. Tested with WB in Human,Rat.

Sequenz: RGQNMLDGGA PFYTTYRTAD GEFMAVGAIE PQFYELLIK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Alpha-methylacyl-CoA racemase(AMACR) detection. Tested with WB in Human,Rat.
Gene Name: alpha-methylacyl-CoA racemase
Protein Name: Alpha-methylacyl-CoA racemase

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human AMACR (208-246aa RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK), different from the related mouse and rat sequences by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-AMACR Antikörper (ABIN4886454)

Wang, Tian, Xiao, Zhang, Sun, Tang: "A metanephric adenoma of the kidney associated with polycythemia: A case report." in: Oncology letters, Vol. 11, Issue 1, pp. 352-354, (2016) (PubMed).

Details zu AMACR

Target: AMACR (alpha-Methylacyl-CoA Racemase (AMACR))

Andere Bezeichnung: AMACR (AMACR Produkte)

Synonyme: AMACR antikoerper, DKFZp469O1232 antikoerper, amacr antikoerper, NCU04099.1 antikoerper, MGC89832 antikoerper, AMACRD antikoerper, CBAS4 antikoerper, RACE antikoerper, RM antikoerper, Macr1 antikoerper, Da1-8 antikoerper, Marc1 antikoerper, alpha-methylacyl-CoA racemase antikoerper, PROBABLE ALPHA-METHYLACYL-COA RACEMASE MCR (2-methylacyl-CoA racemase) (2-arylpropionyl-CoA epimerase) antikoerper, Alpha-methylacyl-CoA racemase antikoerper, alpha-methylacyl-CoA racemase L homeolog antikoerper, AMACR antikoerper, mcr antikoerper, BPSL0064 antikoerper, Maqu_2037 antikoerper, UREG_03852 antikoerper, MCYG_01809 antikoerper, amacr antikoerper, amacr.L antikoerper, MGYG_04259 antikoerper, NCU04099 antikoerper, Amacr antikoerper

Hintergrund: Alpha-methylacyl-CoA racemase (AMACR) is a mitochondrial and peroxisomal enzyme. It encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.

Synonyms: 2 arylpropionyl CoA epimerase | 2 methylacyl CoA racemase | 2-methylacyl-CoA racemase | Alpha methylacyl CoA racemase | Alpha-methylacyl-CoA racemase | Amacr | CBAS4 | Da1-8 | Macr1 | RACE | RM | Q9UHK6

Gen-ID: 23600

Pathways: Monocarboxylic Acid Catabolic Process