CD36 Antikörper (N-Term)

Produktnummer ABIN3043804

Produktdetails anti-CD36 Antikörper

Target: CD36

Bindungsspezifität: AA 31-66, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CD36 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Platelet glycoprotein 4(CD36) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: DLLIQKTIKK QVVLEEGTIA FKNWVKTGTE VYRQFW

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Platelet glycoprotein 4(CD36) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: CD36 Molecule (thrombospondin receptor)
Protein Name: Platelet glycoprotein 4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CD36

Target: CD36

Andere Bezeichnung: CD36 (CD36 Produkte)

Synonyme: BDPLT10 antikoerper, CHDS7 antikoerper, FAT antikoerper, GP3B antikoerper, GP4 antikoerper, GPIV antikoerper, PASIV antikoerper, SCARB3 antikoerper, Fat antikoerper, Scarb3 antikoerper, GPIIIB antikoerper, PAS-4 antikoerper, zgc:92513 antikoerper, CD36 molecule antikoerper, CD36 molecule (thrombospondin receptor) antikoerper, CD36 antikoerper, Cd36 antikoerper, cd36 antikoerper

Hintergrund: CD36 (cluster of differentiation 36), also known as FAT (fatty acid translocase), FAT/CD36, (FAT)/CD36, SCARB3, GP88, glycoprotein IV (gpIV), and glycoprotein IIIb (gpIIIb), is anintegral membrane protein found on the surface of many cell types in vertebrate animals. CD36 is a member of the class B scavenger receptor family of cell surface proteins. It is mapped to 7q21.11. And CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. In addition, CD36 function in long-chain fatty acid uptake and signaling can be irreversibly inhibited by sulfo-N-succinimidyl oleate (SSO), which binds lysine 164 within a hydrophobic pocked shared by several CD36 ligands, e.g. fatty acid and oxLDL.

Synonyms: Adipocyte membrane protein antibody|CD36 antibody|CD36 antibody|CD36 antigen (collagen type I receptor, thrombospondin receptor) antibody|CD36 antigen antibody|CD36 Molecule (thrombospondin receptor) antibody|CD36 Molecule antibody|CD36_HUMAN antibody|CHDS7 antibody|Cluster determinant 36 antibody|Collagen receptor, platelet antibody|FAT antibody| Fatty acid translocase antibody|Fatty acid transport protein antibody|Glycoprotein IIIb antibody|GP IIIb antibody|GP3B antibody|GP4 antibody|GPIIIB antibody|GPIV antibody| Leukocyte differentiation antigen CD36 antibody|MGC108510 antibody|MGC91634 antibody|PAS 4 protein antibody|PAS IV antibody|PAS-4 antibody|PASIV antibody|Platelet collagen receptor antibody|Platelet glycoprotein 4 antibody|Platelet glycoprotein IV antibody|scarb3 antibody|Scavenger receptor class B member 3 antibody|Thrombospondin receptor antibody

Gen-ID: 948

UniProt: P16671

Pathways: TLR Signalweg, Peptide Hormone Metabolism, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Hepatitis C, Toll-Like Receptors Cascades, Lipid Metabolism, S100 Proteine