CD36 Antikörper (AA 31-66)

Produktnummer ABIN2739295

Dieses Anti-CD36-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CD36 in WB, IHC und IHC (p). Geeignet für Human, Maus und Ratte.

Kurzübersicht für CD36 Antikörper (AA 31-66) (ABIN2739295)

Target: CD36

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CD36 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-CD36 Antikörper

Bindungsspezifität: AA 31-66

Aufreinigung: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Details zu CD36

Target: CD36

Andere Bezeichnung: CD36

Hintergrund: Name/Gene ID: CD36

Synonyms: CD36, Cluster determinant 36, FAT, Fatty acid translocase, Glycoprotein IIIb, gp4, GPIIIB, GPIV, PAS-4 protein, PAS IV, PASIV, Platelet collagen receptor, Platelet glycoprotein IV, SCARB3, Thrombospondin receptor, BDPLT10, CD36 antigen, CHDS7, gp3B, PAS-4, Platelet glycoprotein 4

Gen-ID: 948

Pathways: TLR Signalweg, Peptide Hormone Metabolism, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Hepatitis C, Toll-Like Receptors Cascades, Lipid Metabolism, S100 Proteine