AIF Antikörper (AA 582-613)

Produktnummer ABIN2738204

Produktdetails anti-AIF Antikörper

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Bindungsspezifität: AA 582-613

Reaktivität: Human, Maus, Ratte, Schwein, Rind (Kuh), Pferd, Kaninchen, Affe, Hamster, Fledermaus, Gibbon

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AIF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Spezifität: Detected in muscle and skin fibroblasts (at protein level). Isoform 5 is frequently down-regulated in human cancers. .

Aufreinigung: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Details zu AIF

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Andere Bezeichnung: AIFM1 / AIF / PDCD8 (AIFM1 Produkte)

Synonyme: AIF antikoerper, CMTX4 antikoerper, COWCK antikoerper, COXPD6 antikoerper, PDCD8 antikoerper, CG7263 antikoerper, DmAIF antikoerper, Dmel\\CG7263 antikoerper, GB16024 antikoerper, DDBDRAFT_0187853 antikoerper, DDBDRAFT_0191137 antikoerper, DDB_0187853 antikoerper, DDB_0191137 antikoerper, aif antikoerper, pdcd8 antikoerper, AIFM1 antikoerper, PCD8 antikoerper, AIFsh2 antikoerper, Hq antikoerper, Pdcd8 antikoerper, mAIF antikoerper, Aif antikoerper, zgc:91994 antikoerper, apoptosis inducing factor mitochondria associated 1 antikoerper, allograft inflammatory factor 1 antikoerper, Apoptosis inducing factor antikoerper, apoptosis-inducing factor 1, mitochondrial antikoerper, apoptosis inducing factor antikoerper, apoptosis inducing factor, mitochondria associated 1 antikoerper, apoptosis-inducing factor, mitochondrion-associated, 1 antikoerper, apoptosis-inducing factor, mitochondrion-associated 1 antikoerper, AIFM1 antikoerper, AIF1 antikoerper, AIF antikoerper, LOC412212 antikoerper, aif antikoerper, aifm1 antikoerper, Aifm1 antikoerper

Hintergrund: Name/Gene ID: AIFM1
Family: Apoptosis

Synonyms: AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8

Gen-ID: 9131

Pathways: Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, Warburg Effekt