TLR4 Antikörper (AA 161-192)

Produktnummer ABIN1819425

Dieses Anti-TLR4-Antikörper ist ein Ziege Polyklonal-Antikörper zur Detektion von TLR4 in WB, IHC und IHC (p). Geeignet für Human und Maus.

Kurzübersicht für TLR4 Antikörper (AA 161-192) (ABIN1819425)

Target: TLR4 (Toll-Like Receptor 4 (TLR4))

Reaktivität: Human, Maus

Wirt: Ziege

Klonalität: Polyklonal

Konjugat: Dieser TLR4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-TLR4 Antikörper

Bindungsspezifität: AA 161-192

Spezifität: Recognizes the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kD single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity. Recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling. Is reported to be suitable for use in immunocytochemistry on acetone fixed cells.

Aufreinigung: Affinity purified

Immunogen: Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284. Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%), Gorilla, Baboon, Monkey (97%), Hamster (87%), Sheep, Goat, Dolphin, Zebu, Bovine, Guinea pig (84%), Panda, Cat, Pig (81%).

Type of Immunogen: Synthetic peptide

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Approved: IHC, IHC-P (1:100 - 1:300), WB (1:1000)

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: PBS, 0.1 % sodium azide, 0.1 % BSA

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: 4°C or -20°C, Avoid freeze-thaw cycles.

Details zu TLR4

Target: TLR4 (Toll-Like Receptor 4 (TLR4))

Andere Bezeichnung: TLR4

Hintergrund: Name/Gene ID: TLR4
Family: Toll-like Receptor

Synonyms: TLR4, CD284, CD284 antigen, Homolog of Drosophila toll, TLR-4, TOLL, ARMD10, Toll-like receptor 4, HToll

Gen-ID: 7099

UniProt: O00206

Pathways: TLR Signalweg, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades, Inflammasome, S100 Proteine