AIF Antikörper (AA 151-180)

Produktnummer ABIN1099879

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch AIF in WB, IHC und IHC (p). Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für AIF Antikörper (AA 151-180) (ABIN1099879)

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AIF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-AIF Antikörper

Bindungsspezifität: AA 151-180

Marke: IHC-plus™

Aufreinigung: Affinity purified

Immunogen: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Approved: IHC, IHC-P (5 μg/mL), WB

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: TBS containing 50 % glycerol, 0.5 mg/mL BSA, and 0.02 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles.

Details zu AIF

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Andere Bezeichnung: AIFM1 / AIF / PDCD8

Hintergrund: Name/Gene ID: AIFM1
Family: Apoptosis

Synonyms: AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8

Gen-ID: 9131

UniProt: O95831

Pathways: Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, Warburg Effekt