anti-Schwein FZD10 Antikörper für Immunofluorescence

Recommended FZD10 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Frizzled Family Receptor 10 (FZD10) Antikörper
  • CD350
  • FZ-10
  • Fz10
  • FzE7
  • hFz10
  • cFz-10
  • Fz-10
  • Xfr9
  • Xfz10
  • frizzled-10
  • frizzled10
  • fz10
  • fze7
  • hfz10
  • fk48e04
  • fz4
  • fzb
  • wu:fk48e04
  • zg04
  • Fzd10
  • Xfz10B
  • Xfz9
  • fzd10b
  • fzd9
  • frizzled class receptor 10
  • frizzled class receptor 2
  • frizzled class receptor 10 S homeolog
  • FZD10
  • fzd10
  • Fzd10
  • Fzd2
  • fzd10.S
Reaktivität
Rind (Kuh), Hund, Pferd, Human, Maus, Schwein
55
47
25
6
3
3
3
2
2
2
1
Wirt
Kaninchen
62
Klonalität
Polyklonal
Konjugat
Dieser FZD10 Antikörper ist unkonjugiert
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunofluorescence (IF)
36
20
15
13
9
7
3
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Produktnummer ABIN5516677
$ 289.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2602863 IF Rabbit Anmelden zum Anzeigen Polyclonal

General

Antigen Frizzled Family Receptor 10 (FZD10) Antikörper
Reaktivität Rind (Kuh), Hund, Pferd, Human, Maus, Schwein
(55), (47), (25), (6), (3), (3), (3), (2), (2), (2), (1)
Wirt Kaninchen
(62)
Klonalität
Polyklonal
Konjugat Dieser FZD10 Antikörper ist unkonjugiert
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunofluorescence (IF)
(36), (20), (15), (13), (9), (7), (3), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-FZD10 Antikörper

Target Details FZD10 Anwendungsinformationen Handhabung Bilder
Sequenz GMWIWTSKTL QSWQQVCSRR LKKKSRRKPA SVITSGGIYK KAQHPQKTHH
Homologie Cow: 92%, Dog: 92%, Horse: 92%, Human: 100%, Mouse: 92%, Pig: 100%
Reinigung Affinity Purified
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH

Target Details FZD10

Produktdetails anti-FZD10 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung FZD10 (FZD10 Antibody Abstract)
Hintergrund This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.

Alias Symbols: Fz10, FzE7, CD350, FZ-10, hFz10,

Protein Size: 581
Gen-ID 11211
NCBI Accession NM_007197, NP_009128
UniProt Q9ULW2
Pathways WNT Signalweg

Anwendungsinformationen

Produktdetails anti-FZD10 Antikörper Target Details FZD10 Handhabung Bilder zurück nach oben
Applikationshinweise Optimal working dilution should be determined by the investigator.
Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-FZD10 Antikörper Target Details FZD10 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.