anti-Human GAB2 Antikörper für Immunofluorescence

Recommended GAB2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
GRB2-Associated Binding Protein 2 (GAB2) Antikörper
  • GAB2
  • AI463667
  • D130058I17Rik
  • p97
  • GRB2-associated binding protein 2
  • growth factor receptor bound protein 2-associated protein 2
  • GAB2
  • LOC100349301
  • gab2
  • Gab2
Reaktivität
Human
180
140
134
3
2
1
1
1
1
1
1
Wirt
Kaninchen
165
16
1
Klonalität
Polyklonal
Konjugat
Dieser GAB2 Antikörper ist unkonjugiert
6
6
6
5
5
5
5
5
5
5
5
5
5
5
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
116
65
59
30
30
4
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5076879
Preis und Verfügbarkeit auf Anfrage.

General

Antigen GRB2-Associated Binding Protein 2 (GAB2) Antikörper
Reaktivität Human
(180), (140), (134), (3), (2), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(165), (16), (1)
Klonalität
Polyklonal
Konjugat Dieser GAB2 Antikörper ist unkonjugiert
(6), (6), (6), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(116), (65), (59), (30), (30), (4), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-GAB2 Antikörper

Target Details GAB2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDST
Isotyp IgG

Target Details GAB2

Produktdetails anti-GAB2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung GAB2 (GAB2 Antibody Abstract)
Hintergrund Gene Symbol: GAB2
Gen-ID 9846
Pathways T-Zell Rezeptor Signalweg, Fc-epsilon Rezeptor Signalübertragung, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process

Anwendungsinformationen

Produktdetails anti-GAB2 Antikörper Target Details GAB2 Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-GAB2 Antikörper Target Details GAB2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-GAB2 Antikörper Target Details GAB2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-GRB2-Associated Binding Protein 2 (GAB2) antibody (ABIN5076879) Immunocytochemistry/Immunofluorescence: GAB2 Antibody - Staining of human cell line ...