anti-Human Translocase of Inner Mitochondrial Membrane 9 Homolog (Yeast) Antikörper für Immunofluorescence

Recommended Translocase of Inner Mitochondrial Membrane 9 Homolog (Yeast) Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Translocase of Inner Mitochondrial Membrane 9 Homolog (Yeast) (TIMM9) Antikörper
  • TIMM9
  • timm9
  • emb2474
  • embryo defective 2474
  • 2810011L15Rik
  • Tim10a
  • Timm10
  • TIM9
  • TIM9A
  • Tim9
  • Tim9a
  • Timm9a
  • translocase of inner mitochondrial membrane 9 homolog (yeast)
  • mitochondrial import inner membrane translocase subunit Tim9
  • Mitochondrial protein import
  • translocase of inner mitochondrial membrane 9
  • translocase of inner mitochondrial membrane 9 homolog
  • TIMM9
  • timm9
  • TIM9
  • Timm9
Reaktivität
Human
21
6
6
Wirt
Kaninchen
12
9
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
20
14
14
4
3
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4359788
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2701965 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2975213 ICC IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5589526 IF IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Translocase of Inner Mitochondrial Membrane 9 Homolog (Yeast) (TIMM9) Antikörper
Reaktivität Human
(21), (6), (6)
Wirt Kaninchen
(12), (9)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(20), (14), (14), (4), (3), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Antigen
Andere Bezeichnung TIMM9 (TIMM9 Antibody Abstract)
Hintergrund Gene Symbol: TIMM9
Gen-ID 26520
Forschungsgebiet Neurology
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:2500-1:5000For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen

Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Sotgia, Whitaker-Menezes, Martinez-Outschoorn, Salem, Tsirigos, Lamb, Sneddon, Hulit, Howell, Lisanti: "Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells." in: Cell cycle (Georgetown, Tex.), Vol. 11, Issue 23, pp. 4390-401, 2012 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Translocase of Inner Mitochondrial Membrane 9 Homolog (Yeast) (TIMM9) antibody (ABIN4359788) Immunocytochemistry/Immunofluorescence: TIMM9 Antibody - Immunofluorescent staining ...