anti-Human SRRM4 Antikörper für Immunohistochemistry

Recommended SRRM4 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Serine/arginine Repetitive Matrix 4 (SRRM4) Antikörper
  • KIAA1853
  • MU-MB-2.76
  • nSR100
  • SRRM2C
  • 1500001A10Rik
  • B230202K19Rik
  • mKIAA1853
  • RGD1560213
  • ZnSR100
  • im:7136231
  • si:dkey-1k23.1
  • serine/arginine repetitive matrix 4
  • SRRM4
  • Srrm4
  • srrm4
Reaktivität
Human
6
3
2
2
1
1
1
1
1
Wirt
Kaninchen
6
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
6
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4356006
Preis und Verfügbarkeit auf Anfrage.

General

Antigen Serine/arginine Repetitive Matrix 4 (SRRM4) Antikörper
Reaktivität Human
(6), (3), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(6)
Klonalität
Polyklonal
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(6), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-SRRM4 Antikörper

Target Details SRRM4 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ASVQQGEKQLFEKFWRGTFKAVATPRPESIIVASITARKPLPRTEPQNNPVVPAQDGPSEKLGQHLATEPLGTNSWERDKTCRELG
Isotyp IgG

Target Details SRRM4

Produktdetails anti-SRRM4 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung SRRM4 (SRRM4 Antibody Abstract)
Hintergrund Gene Symbol: SRRM4
Gen-ID 84530
UniProt A7MD48
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails anti-SRRM4 Antikörper Target Details SRRM4 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-SRRM4 Antikörper Target Details SRRM4 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-SRRM4 Antikörper Target Details SRRM4 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Serine/arginine Repetitive Matrix 4 (SRRM4) antibody (ABIN4356006) Immunohistochemistry: SRRM4 Antibody [NBP2-31389] - liver
Immunohistochemistry (IHC) image for anti-Serine/arginine Repetitive Matrix 4 (SRRM4) antibody (ABIN4356006) Immunohistochemistry: SRRM4 Antibody [NBP2-31389] - Staining of human cerebral cortex...
Immunohistochemistry (IHC) image for anti-Serine/arginine Repetitive Matrix 4 (SRRM4) antibody (ABIN4356006) Immunohistochemistry: SRRM4 Antibody [NBP2-31389] - melanoma