anti-Human Otoraplin Antikörper für Immunofluorescence

Recommended Otoraplin Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Otoraplin (OTOR) Antikörper
  • MGC133655
  • MGC86203
  • Fdp
  • FDP
  • MIAL1
  • CDRAP
  • MIA
  • MIAL
  • otoraplin
  • Otoraplin
  • fructose-1,6-bisphosphatase 1
  • OTOR
  • otor
  • LOC100347646
  • Fbp1
  • Otor
Reaktivität
Human
3
2
1
Wirt
Kaninchen
4
Klonalität
Polyklonal
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
3
2
2
1
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4341953
Preis und Verfügbarkeit auf Anfrage.

General

Antigen Otoraplin (OTOR) Antikörper
Reaktivität Human
(3), (2), (1)
Wirt Kaninchen
(4)
Klonalität
Polyklonal
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(3), (2), (2), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Otoraplin/OTOR (OTOR Antibody Abstract)
Hintergrund Gene Symbol: OTOR
Gen-ID 56914
Pathways Sensory Perception of Sound, Regulation of Carbohydrate Metabolic Process

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Otoraplin (OTOR) antibody (ABIN4341953) Immunocytochemistry/Immunofluorescence: OTOR Antibody [NBP1-83912] - Staining of huma...
Western Blotting (WB) image for anti-Otoraplin (OTOR) antibody (ABIN4341953) Western Blot: OTOR Antibody [NBP1-83912] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Otoraplin (OTOR) antibody (ABIN4341953) Immunohistochemistry-Paraffin: OTOR Antibody [NBP1-83912] - Staining of human appendi...