anti-Human OTOA Antikörper für Immunohistochemistry

Recommended OTOA Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Otoancorin (OTOA) Antikörper
  • CT108
  • DFNB22
  • RGD1562741
  • otoancorin
  • OTOA
  • otoa
  • Otoa
Reaktivität
Human
35
20
15
Wirt
Kaninchen
36
1
Klonalität
Polyklonal
Konjugat
Dieser OTOA Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
23
15
15
13
8
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4341945
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2582241 ELISA IHC WB Rabbit IgG AA 99-127 Anmelden zum Anzeigen Polyclonal

General

Antigen Otoancorin (OTOA) Antikörper
Reaktivität Human
(35), (20), (15)
Wirt Kaninchen
(36), (1)
Klonalität
Polyklonal
Konjugat Dieser OTOA Antikörper ist unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(23), (15), (15), (13), (8), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-OTOA Antikörper

Target Details OTOA Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RCMEEDTFIRTVELLGAVQGFSRPQLMTLKEKAIQVWDMPSYWREHHIVSLGRIALALNESELEQLDLSSIDTVASLSWQTEWTP
Isotyp IgG

Target Details OTOA

Produktdetails anti-OTOA Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung OTOA (OTOA Antibody Abstract)
Hintergrund Gene Symbol: OTOA
Gen-ID 146183
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails anti-OTOA Antikörper Target Details OTOA Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-OTOA Antikörper Target Details OTOA Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-OTOA Antikörper Target Details OTOA Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Otoancorin (OTOA) antibody (ABIN4341945) Immunohistochemistry: OTOA Antibody [NBP1-84363] - Staining of human spleen shows str...