anti-Human Gap Junction Protein, gamma 3, 30.2kDa Antikörper für Immunofluorescence

Recommended Gap Junction Protein, gamma 3, 30.2kDa Antibody (geliefert von: Anmelden zum Anzeigen )

Gap Junction Protein, gamma 3, 30.2kDa (GJc3) Antikörper
  • Cx29
  • Gje1
  • CX29
  • CX30.2
  • CX31.3
  • GJE1
  • gap junction protein, gamma 3, 30.2kDa
  • gap junction protein, gamma 3
  • LOC100349037
  • Gjc3
  • GJC3
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4314210
Preis und Verfügbarkeit auf Anfrage.


Antigen Gap Junction Protein, gamma 3, 30.2kDa (GJc3) Antikörper
Reaktivität Human
(46), (20), (17), (3)
Wirt Kaninchen
(52), (13)
Konjugat Unkonjugiert
(4), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(37), (36), (13), (4), (2), (1)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung GJC3 (GJc3 Antibody Abstract)
Hintergrund Gene Symbol: GJC3
Gen-ID 349149
Pathways Sensory Perception of Sound


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Gap Junction Protein, gamma 3, 30.2kDa (GJc3) antibody (ABIN4314210) Immunohistochemistry-Paraffin: GJC3 Antibody [NBP1-88040] - Staining of human cerebel...
Immunofluorescence (IF) image for anti-Gap Junction Protein, gamma 3, 30.2kDa (GJc3) antibody (ABIN4314210) Immunocytochemistry/Immunofluorescence: GJC3 Antibody [NBP1-88040] - Staining of huma...