anti-Zebrafisch (Danio rerio) gamma-aminobutyric Acid (GABA) A Receptor, beta 2 Antikörper für Western Blotting

Recommended gamma-aminobutyric Acid (GABA) A Receptor, beta 2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2) Antikörper
  • GABRB2
  • GARB2
  • fj59e04
  • gabaabeta2
  • wu:fj59e04
  • zgc:136311
  • GABARB
  • AI834970
  • C030002O17Rik
  • C030021G16Rik
  • Gabrab2
  • Gabrb-2
  • gamma-aminobutyric acid (GABA) A receptor, beta 2
  • gamma-aminobutyric acid (GABA) A receptor, subunit beta 2
  • GABRB2
  • gabrb2
  • Gabrb2
Reaktivität
Human, Maus, Ratte (Rattus), Hund, Zebrafisch (Danio rerio)
75
58
51
17
14
9
9
9
8
8
5
5
5
3
3
1
1
1
Wirt
Kaninchen
73
14
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
4
4
4
3
3
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
61
34
13
10
5
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN633763
$ 473.93
Zzgl. Versandkosten $45.00

General

Antigen gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2) Antikörper
Reaktivität Human, Maus, Ratte (Rattus), Hund, Zebrafisch (Danio rerio)
(75), (58), (51), (17), (14), (9), (9), (9), (8), (8), (5), (5), (5), (3), (3), (1), (1), (1)
Wirt Kaninchen
(73), (14)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(4), (4), (4), (4), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(61), (34), (13), (10), (5), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Reinigung Affinity purified
Immunogen GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung GABRB2 (GABRB2 Antibody Abstract)
Hintergrund The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor. The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system.
Molekulargewicht 55 kDa (MW of target protein)
Forschungsgebiet Neurology
Pathways Sensory Perception of Sound, Synaptic Membrane

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

GABRB2 Blocking Peptide, catalog no. 33R-3806, is also available for use as a blocking control in assays to test for specificity of this GABRB2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRB2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2) antibody (ABIN633763) GABRB2 antibody used at 0.5 ug/ml to detect target protein.