anti-Human EYA4 Antikörper für Immunocytochemistry

Recommended EYA4 Antibody (geliefert von: Anmelden zum Anzeigen )

Eyes Absent Homolog 4 (Drosophila) (EYA4) Antikörper
  • B130023L16Rik
  • CMD1J
  • DFNA10
  • eyes absent 4 homolog (Drosophila)
  • eyes absent homolog 4 (Drosophila)
  • Eya4
  • EYA4
Human, Maus, Ratte (Rattus)
Dieser EYA4 Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4309815
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN3060723 ICC IF WB Rabbit Anmelden zum Anzeigen Polyclonal


Antigen Eyes Absent Homolog 4 (Drosophila) (EYA4) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(66), (22), (18), (6), (5), (3), (2), (2), (2), (2)
Wirt Kaninchen
(51), (16)
Konjugat Dieser EYA4 Antikörper ist unkonjugiert
(4), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(37), (29), (21), (18), (17), (13), (3), (3), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-EYA4 Antikörper

Target Details EYA4 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QYAQYYSASTYGAYMTSNNTADGTPSSTSTYQLQESLPGLTNQPGEFDTMQSPSTPIKDLDERTCRSSGSKS
Isotyp IgG

Target Details EYA4

Produktdetails anti-EYA4 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung EYA4 (EYA4 Antibody Abstract)
Hintergrund Gene Symbol: EYA4
Gen-ID 2070
Pathways Sensory Perception of Sound


Produktdetails anti-EYA4 Antikörper Target Details EYA4 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-EYA4 Antikörper Target Details EYA4 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-EYA4 Antikörper Target Details EYA4 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Eyes Absent Homolog 4 (Drosophila) (EYA4) antibody (ABIN4309815) Immunocytochemistry/Immunofluorescence: EYA4 Antibody [NBP1-85546] - Immunofluorescen...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Eyes Absent Homolog 4 (Drosophila) (EYA4) antibody (ABIN4309815) Immunohistochemistry-Paraffin: EYA4 Antibody [NBP1-85546] - Staining of human colon s...
Western Blotting (WB) image for anti-Eyes Absent Homolog 4 (Drosophila) (EYA4) antibody (ABIN4309815) Western Blot: EYA4 Antibody [NBP1-85546] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...