anti-Human LMTK2 Antikörper für Immunocytochemistry

Recommended LMTK2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Lemur tyrosine Kinase 2 (LMTK2) Antikörper
  • AATYK2
  • BREK
  • KPI-2
  • KPI2
  • LMR2
  • cprk
  • 2900041G10Rik
  • A330101P12Rik
  • aatyk2
  • lemur tyrosine kinase 2
  • LMTK2
  • Lmtk2
Reaktivität
Human
68
3
2
2
1
1
1
Wirt
Kaninchen
43
15
10
Klonalität
Polyklonal
Konjugat
Dieser LMTK2 Antikörper ist unkonjugiert
3
3
3
3
3
3
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
61
47
28
14
8
6
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4331265
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5077881 ICC IF Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Lemur tyrosine Kinase 2 (LMTK2) Antikörper
Reaktivität Human
(68), (3), (2), (2), (1), (1), (1)
Wirt Kaninchen
(43), (15), (10)
Klonalität
Polyklonal
Konjugat Dieser LMTK2 Antikörper ist unkonjugiert
(3), (3), (3), (3), (3), (3)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(61), (47), (28), (14), (8), (6), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-LMTK2 Antikörper

Target Details LMTK2 Anwendungsinformationen Handhabung Referenzen für anti-LMTK2 Antikörper (ABIN4331265) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MELNGVQADFKPATLSSSLDNPKESVITGHFEKEKPRKIFDSEPLCLSDNLMHQDNFDPLNVQELSENFLFLQEKNLLKGSLSSKEHINDLQTELKNAGFTEAMLETSCRNSLDTELQFAENKPGLSLLQENV
Isotyp IgG

Target Details LMTK2

Produktdetails anti-LMTK2 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-LMTK2 Antikörper (ABIN4331265) Bilder zurück nach oben
Antigen
Andere Bezeichnung LMTK2 (LMTK2 Antibody Abstract)
Hintergrund Gene Symbol: LMTK2
Gen-ID 22853
Pathways RTK Signalweg, Neurotrophin Signalübertragung

Anwendungsinformationen

Produktdetails anti-LMTK2 Antikörper Target Details LMTK2 Handhabung Referenzen für anti-LMTK2 Antikörper (ABIN4331265) Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-LMTK2 Antikörper Target Details LMTK2 Anwendungsinformationen Referenzen für anti-LMTK2 Antikörper (ABIN4331265) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-LMTK2 Antikörper (ABIN4331265)

Produktdetails anti-LMTK2 Antikörper Target Details LMTK2 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Shah, Bradbury: "Lemur Tyrosine Kinase 2, a novel target in prostate cancer therapy." in: Oncotarget, Vol. 6, Issue 16, pp. 14233-46, 2015 (Probematerial (Species): Human). Weitere Details: Immunocytochemistry,Immunofluorescence

Bilder

Produktdetails anti-LMTK2 Antikörper Target Details LMTK2 Anwendungsinformationen Handhabung Referenzen für anti-LMTK2 Antikörper (ABIN4331265) zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Lemur tyrosine Kinase 2 (LMTK2) antibody (ABIN4331265) Immunocytochemistry/Immunofluorescence: LMTK2 Antibody [NBP1-89320] - Immunofluoresce...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Lemur tyrosine Kinase 2 (LMTK2) antibody (ABIN4331265) Immunohistochemistry-Paraffin: LMTK2 Antibody [NBP1-89320] - Staining of human skelet...
Immunofluorescence (IF) image for anti-Lemur tyrosine Kinase 2 (LMTK2) antibody (ABIN4331265) Immunocytochemistry/Immunofluorescence: LMTK2 Antibody - Staining of human cell line...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Lemur tyrosine Kinase 2 (LMTK2) antibody (ABIN4331265) Immunohistochemistry-Paraffin: LMTK2 Antibody - Staining of human colon shows cytopl...