anti-Human FGF3 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended FGF3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Fibroblast Growth Factor 3 (FGF3) Antikörper
  • HBGF-3
  • INT2
  • Int2
  • Fgf-3
  • Int-2
  • Int-P
  • INT-2
  • XFGF-3
  • fgf3-A
  • xfgf3
  • FGF-3
  • id:ibd5006
  • fibroblast growth factor 3
  • FGF3
  • Fgf3
  • fgf3
Reaktivität
Human
68
40
24
21
3
3
3
2
2
2
2
2
2
1
Wirt
Kaninchen
39
31
Klonalität
Polyklonal
Konjugat
Dieser FGF3 Antikörper ist unkonjugiert
5
4
3
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
53
36
25
16
13
11
4
4
3
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4311605
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN674004 IF (p) IHC (p) WB Rabbit IgG AA 75-125 Anmelden zum Anzeigen Polyclonal
1 ABIN674013 IHC (p) WB HRP Rabbit IgG AA 75-125 Anmelden zum Anzeigen Polyclonal
1 ABIN674006 IHC (p) WB Biotin Rabbit IgG AA 75-125 Anmelden zum Anzeigen Polyclonal
1 ABIN3201728 ICC IHC (fro) IHC (p) ELISA WB Mouse IgG AA 154-232 Anmelden zum Anzeigen
1 ABIN4272064 IHC (fro) IHC (p) WB Biotin Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN4272063 BP IHC IHC (p) Neut WB Mouse IgG1 Anmelden zum Anzeigen MM0287-3F18
1 ABIN4272066 IHC (fro) IHC (p) WB Alexa Fluor 488 Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN4272072 IHC (fro) IHC (p) WB DyLight 680 Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN4272070 IHC (fro) IHC (p) WB DyLight 650 Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN4272071 IHC (fro) IHC (p) FITC Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN4272078 IHC (fro) IHC (p) WB DyLight 550 Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN4272068 IHC (fro) IHC (p) WB Alexa Fluor 700 Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN4272065 IHC (fro) IHC (p) WB Alexa Fluor 405 Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN4272075 IHC (fro) IHC (p) WB DyLight 755 Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN4272079 IHC (fro) IHC (p) WB DyLight 350 Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN4272073 IHC (fro) IHC (p) WB DyLight 488 Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN4272080 IHC (fro) IHC (p) WB DyLight 405 Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN4272067 IHC (fro) IHC (p) WB Alexa Fluor 647 Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN268314 IF IHC IHC (fro) IHC (p) IP WB Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN2620832 IHC (p) WB Rabbit AA 160-209 Anmelden zum Anzeigen Polyclonal

Ähnliche anti-FGF3 Antikörper

Applikation / Reaktivität Human
Blocking Peptide (BP) 1 Antikörper
ELISA 11 Antikörper
Immunochromatography (IC) 1 Antikörper
Immunocytochemistry (ICC) 5 Antikörper
Immunofluorescence (IF) 5 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 1 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper
Immunohistochemistry (IHC) 26 Antikörper
Immunohistochemistry (Frozen Sections) (IHC (fro)) 16 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 37 Antikörper
Immunoprecipitation (IP) 3 Antikörper
Neutralization (Neut) 2 Antikörper
Western Blotting (WB) 51 Antikörper

General

Antigen Fibroblast Growth Factor 3 (FGF3) Antikörper
Reaktivität Human
(68), (40), (24), (21), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1)
Wirt Kaninchen
(39), (31)
Klonalität
Polyklonal
Konjugat Dieser FGF3 Antikörper ist unkonjugiert
(5), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(53), (36), (25), (16), (13), (11), (4), (4), (3), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-FGF3 Antikörper

Target Details FGF3 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPS
Isotyp IgG

Target Details FGF3

Produktdetails anti-FGF3 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung FGF-3 (FGF3 Antibody Abstract)
Hintergrund Gene Symbol: FGF3
Gen-ID 2248
Pathways RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung

Anwendungsinformationen

Produktdetails anti-FGF3 Antikörper Target Details FGF3 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-FGF3 Antikörper Target Details FGF3 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-FGF3 Antikörper Target Details FGF3 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-FGF3 Antikörper (Fibroblast Growth Factor 3) (ABIN4311605) Immunohistochemistry-Paraffin: FGF-3 Antibody [NBP1-89718] - Staining of human placen...
Immunofluorescence (IF) image for anti-FGF3 Antikörper (Fibroblast Growth Factor 3) (ABIN4311605) Immunocytochemistry/Immunofluorescence: FGF-3 Antibody [NBP1-89718] - Staining of hum...