anti-Ratte (Rattus) SPTBN1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended SPTBN1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Spectrin Beta, Non-Erythrocytic 1 (SPTBN1) Antikörper
  • 9930031C03Rik
  • AL033301
  • SPTB2
  • Spnb-2
  • Spnb2
  • elf1
  • elf3
  • mKIAA4049
  • ELF
  • betaSpII
  • Spnb1
  • spectrin beta, non-erythrocytic 1
  • spectrin, beta, non-erythrocytic 1
  • Sptbn1
  • SPTBN1
Reaktivität
Human, Maus, Ratte (Rattus)
31
18
11
6
4
4
3
3
2
1
1
1
1
1
1
Wirt
Kaninchen
29
2
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
26
12
9
8
7
6
2
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4355579
Preis und Verfügbarkeit auf Anfrage.

General

Antigen Spectrin Beta, Non-Erythrocytic 1 (SPTBN1) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(31), (18), (11), (6), (4), (4), (3), (3), (2), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(29), (2)
Klonalität
Polyklonal
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(26), (12), (9), (8), (7), (6), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-SPTBN1 Antikörper

Target Details SPTBN1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQEL
Isotyp IgG

Target Details SPTBN1

Produktdetails anti-SPTBN1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Spectrin beta 2 (SPTBN1 Antibody Abstract)
Hintergrund Gene Symbol: SPTBN1
Gen-ID 6711
Pathways Regulation of Actin Filament Polymerization, Protein targeting to Nucleus

Anwendungsinformationen

Produktdetails anti-SPTBN1 Antikörper Target Details SPTBN1 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-SPTBN1 Antikörper Target Details SPTBN1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-SPTBN1 Antikörper Target Details SPTBN1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Spectrin Beta, Non-Erythrocytic 1 (SPTBN1) antibody (ABIN4355579) Immunohistochemistry-Paraffin: Spectrin beta 2 Antibody [NBP1-86088] - Immunohistoche...
Western Blotting (WB) image for anti-Spectrin Beta, Non-Erythrocytic 1 (SPTBN1) antibody (ABIN4355579) Western Blot: Spectrin beta 2 Antibody [NBP1-86088] - Lane 1: NIH-3T3 cell lysate (Mo...
Western Blotting (WB) image for anti-Spectrin Beta, Non-Erythrocytic 1 (SPTBN1) antibody (ABIN4355579) Western Blot: Spectrin beta 2 Antibody [NBP1-86088] - Lane 1: Marker [kDa] 230, 130, ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Spectrin Beta, Non-Erythrocytic 1 (SPTBN1) antibody (ABIN4355579) Immunohistochemistry-Paraffin: Spectrin beta 2 Antibody - Staining of human duodenum...
Immunofluorescence (IF) image for anti-Spectrin Beta, Non-Erythrocytic 1 (SPTBN1) antibody (ABIN4355579) Immunocytochemistry/Immunofluorescence: Spectrin beta 2 Antibody - Immunofluorescent...