anti-Maus PPP2R5B Antikörper für Western Blotting

Recommended PPP2R5B Antibody (geliefert von: Anmelden zum Anzeigen )

Protein Phosphatase 2, Regulatory Subunit B', beta (PPP2R5B) Antikörper
  • PPP2R5B
  • B'beta
  • BC026670
  • 4633401M22Rik
  • AI449017
  • B56beta
  • B56B
  • PR61B
  • protein phosphatase 2, regulatory subunit B', beta
  • protein phosphatase 2A regulatory subunit B'
  • protein phosphatase 2, regulatory subunit B', beta isoform
  • protein phosphatase 2, regulatory subunit B (B56), beta isoform
  • protein phosphatase 2, regulatory subunit B (B56), epsilon isoform
  • PPP2R5B
  • ppp2r5b
  • Ppp2r5b
  • Ppp2r5e
Human, Maus, Ratte (Rattus)
Dieser PPP2R5B Antikörper ist unkonjugiert
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4347110
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5552686 WB Goat C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN290469 WB Goat AA 484-497 Anmelden zum Anzeigen Polyclonal
1 ABIN2442988 WB Rabbit Anmelden zum Anzeigen Polyclonal


Antigen Protein Phosphatase 2, Regulatory Subunit B', beta (PPP2R5B) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(26), (3), (1), (1), (1)
Wirt Kaninchen
(15), (10), (1)
Konjugat Dieser PPP2R5B Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(24), (11)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PPP2R5B Antikörper

Target Details PPP2R5B Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP
Isotyp IgG

Target Details PPP2R5B

Produktdetails anti-PPP2R5B Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung PPP2R5B (PPP2R5B Antibody Abstract)
Hintergrund Gene Symbol: PPP2R5B
Gen-ID 5526
Pathways PI3K-Akt Signalweg, ER-Nucleus Signaling


Produktdetails anti-PPP2R5B Antikörper Target Details PPP2R5B Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-PPP2R5B Antikörper Target Details PPP2R5B Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-PPP2R5B Antikörper Target Details PPP2R5B Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Protein Phosphatase 2, Regulatory Subunit B', beta (PPP2R5B) antibody (ABIN4347110) Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958] - Staining of human cere...
Western Blotting (WB) image for anti-Protein Phosphatase 2, Regulatory Subunit B', beta (PPP2R5B) antibody (ABIN4347110) Western Blot: PPP2R5B Antibody [NBP1-88958] - Lane 1: NIH-3T3 cell lysate (Mouse embr...
Western Blotting (WB) image for anti-Protein Phosphatase 2, Regulatory Subunit B', beta (PPP2R5B) antibody (ABIN4347110) Western Blot: PPP2R5B Antibody [NBP1-88958] - Lane 1: Marker [kDa] 230, 130, 95, 72, ...