RNF43 Antikörper (Middle Region)

Produktnummer ABIN635909

Produktdetails anti-RNF43 Antikörper

Target: RNF43 (Ring Finger Protein 43 (RNF43))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF43 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF43 antibody was raised against the middle region of RNF43

Aufreinigung: Affinity purified

Immunogen: RNF43 antibody was raised using the middle region of RNF43 corresponding to a region with amino acids DFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTGETQVSSHVHYHRH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF43 Blocking Peptide, catalog no. 33R-1926, is also available for use as a blocking control in assays to test for specificity of this RNF43 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF43 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF43

Target: RNF43 (Ring Finger Protein 43 (RNF43))

Andere Bezeichnung: RNF43 (RNF43 Produkte)

Synonyme: RNF124 antikoerper, URCC antikoerper, 4732452J19Rik antikoerper, RGD1305204 antikoerper, ring finger protein 43 antikoerper, RNF43 antikoerper, Rnf43 antikoerper

Hintergrund: RNF43 is a HAP95 (AKAP8L) binding ubiquitin ligase that promotes cell growth and is upregulated in colon cancer.

Molekulargewicht: 86 kDa (MW of target protein)

Pathways: WNT Signalweg