FBXO5 Antikörper (C-Term)

Produktnummer ABIN631366

Produktdetails anti-FBXO5 Antikörper

Target: FBXO5 (F-Box Protein 5 (FBXO5))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXO5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXO5 antibody was raised against the C terminal of FBXO5

Aufreinigung: Affinity purified

Immunogen: FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO5 Blocking Peptide, catalog no. 33R-1541, is also available for use as a blocking control in assays to test for specificity of this FBXO5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXO5

Target: FBXO5 (F-Box Protein 5 (FBXO5))

Andere Bezeichnung: FBXO5 (FBXO5 Produkte)

Synonyme: EMI1 antikoerper, FBX5 antikoerper, Fbxo31 antikoerper, 2510044I10Rik antikoerper, C85305 antikoerper, Emi1 antikoerper, emi1 antikoerper, fc65h02 antikoerper, wu:fc65h02 antikoerper, wu:fe06e07 antikoerper, wu:fz79f03 antikoerper, zgc:136397 antikoerper, zgc:158541 antikoerper, fbx5 antikoerper, Fbxo5 antikoerper, ACYPI007854 antikoerper, fbxo5 antikoerper, F-box protein 5 antikoerper, F-box only protein 5 antikoerper, F-box protein 5 L homeolog antikoerper, F-box protein 5 S homeolog antikoerper, FBXO5 antikoerper, Fbxo5 antikoerper, fbxo5 antikoerper, fbxo5.L antikoerper, fbxo5.S antikoerper

Hintergrund: FBXO5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases