AKR1B10 Antikörper (C-Term)
-
- Target Alle AKR1B10 Antikörper anzeigen
- AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))
-
Bindungsspezifität
- AA 285-316, C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AKR1B10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Aldo-keto reductase family 1 member B10(AKR1B10) detection. Tested with WB, IHC-P in Human.
- Sequenz
- EMATILSFNR NWRACNVLQS SHLEDYPFNA EY
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Aldo-keto reductase family 1 member B10(AKR1B10) detection. Tested with WB, IHC-P in Human.
Gene Name: aldo-keto reductase family 1 member B10
Protein Name: Aldo-keto reductase family 1 member B10 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY).
- Isotyp
- IgG
- Top Product
- Discover our top product AKR1B10 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))
- Andere Bezeichnung
- AKR1B10 (AKR1B10 Produkte)
- Synonyme
- AKR1B11 antikoerper, AKR1B12 antikoerper, ALDRLn antikoerper, ARL-1 antikoerper, ARL1 antikoerper, HIS antikoerper, HSI antikoerper, 2310005E10Rik antikoerper, Akr1b16 antikoerper, AKR antikoerper, AKR1B10 antikoerper, Akr1b10 antikoerper, aldo-keto reductase family 1 member B10 antikoerper, aldo-keto reductase family 1, member B10 (aldose reductase) antikoerper, aldo-keto reductase family 1 member B10-like 2 antikoerper, AKR1B10 antikoerper, Akr1b10 antikoerper, AKR1B10L2 antikoerper, LOC100585902 antikoerper, LOC100723118 antikoerper, LOC101107697 antikoerper
- Hintergrund
-
Aldo-keto reductase family 1 member B10 is an enzyme that in humans is encoded by the AKR1B10 gene. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.
Synonyms: AKR1B10 | AKR1B11 | AKR1B12 | ALDRLn | ARL1 | ARL-1 | ARL 1 | ARP | HIS | HSI | O60218 - Gen-ID
- 57016
- UniProt
- O60218
-