TRPV5 Antikörper (C-Term)
-
- Target Alle TRPV5 Antikörper anzeigen
- TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))
-
Bindungsspezifität
- AA 580-610, C-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRPV5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Transient receptor potential cation channel subfamily V member 5(TRPV5) detection. Tested with WB in Human,Rat.
- Sequenz
- DTHWRVAQER DELWRAQVVA TTVMLERKLP R
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Transient receptor potential cation channel subfamily V member 5(TRPV5) detection. Tested with WB in Human,Rat.
Gene Name: transient receptor potential cation channel, subfamily V, member 5
Protein Name: Transient receptor potential cation channel subfamily V member 5 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human TRPV5 (580-610aa DTHWRVAQERDELWRAQVVATTVMLERKLPR), different from the related mouse and rat sequences by one amino acid.
- Isotyp
- IgG
- Top Product
- Discover our top product TRPV5 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))
- Andere Bezeichnung
- TRPV5 (TRPV5 Produkte)
- Synonyme
- CaT2 antikoerper, Ecac1 antikoerper, CAT2 antikoerper, ECAC1 antikoerper, OTRPC3 antikoerper, D630033B11 antikoerper, TRPV5 antikoerper, ECAC antikoerper, cat2 antikoerper, xcat2 antikoerper, transient receptor potential cation channel, subfamily V, member 5 antikoerper, transient receptor potential cation channel subfamily V member 5 antikoerper, calcium transporter 2 L homeolog antikoerper, Trpv5 antikoerper, TRPV5 antikoerper, LOC100011049 antikoerper, trpv5 antikoerper, cat2.L antikoerper
- Hintergrund
-
Transient receptor potential cation channel subfamily V member 5 is a protein that in humans is encoded by the TRPV5 gene. This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. And this protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. In addition, TRPV5 is mainly expressed in kidney epithelial cells, where it plays an important role in the reabsorption of Ca2+. Genetic deletion of TRPV5 in mice leads to Ca2+ loss in the urine, and consequential hyperparathyroidism, and bone loss.
Synonyms: Calcium transport protein 2 antibody|Calcium transporter 2 antibody|CAT 2 antibody|CAT2 antibody|ECAC 1 antibody|ECaC antibody|ECAC1 antibody|Epithelial calcium channel 1 antibody|Osm 9 like TRP channel 3 antibody|Osm-9-like TRP channel 3 antibody|OTRPC 3 antibody|OTRPC3 antibody|Transient receptor potential cation channel subfamily V member 5 antibody|TRPV 5 antibody|TrpV5 antibody|TRPV5_HUMAN antibody - Gen-ID
- 56302
-