anti-Human PGLYRP2 Antikörper für Immunohistochemistry

Recommended PGLYRP2 Antibody (geliefert von: Anmelden zum Anzeigen )

Peptidoglycan Recognition Protein 2 (PGLYRP2) Antikörper
  • pgrp-l
  • HMFT0141
  • PGRP-L
  • TAGL-like
  • tagL
  • tagL-alpha
  • tagl-beta
  • C730002N09Rik
  • Pglyrpl
  • pPGRP-LB
  • peptidoglycan recognition protein 2
  • pglyrp2
  • Pglyrp2
Dieser PGLYRP2 Antikörper ist unkonjugiert
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4345108
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
9.452184 ABIN4345109 IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN3061263 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal


Antigen Peptidoglycan Recognition Protein 2 (PGLYRP2) Antikörper
Reaktivität Human
(25), (23)
Wirt Kaninchen
(23), (18), (5)
Konjugat Dieser PGLYRP2 Antikörper ist unkonjugiert
(3), (3), (3), (3), (3), (3), (3), (3), (3), (3)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(23), (19), (11), (4), (3), (3), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PGLYRP2 Antikörper

Target Details PGLYRP2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: VWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVP
Isotyp IgG

Target Details PGLYRP2

Produktdetails anti-PGLYRP2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung PGLYRP2/PGRP-L (PGLYRP2 Antibody Abstract)
Hintergrund Gene Symbol: PGLYRP2
Gen-ID 114770
UniProt Q96PD5
Pathways Activation of Innate immune Response, Glycosaminoglycan Metabolic Process


Produktdetails anti-PGLYRP2 Antikörper Target Details PGLYRP2 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-PGLYRP2 Antikörper Target Details PGLYRP2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-PGLYRP2 Antikörper Target Details PGLYRP2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Peptidoglycan Recognition Protein 2 (PGLYRP2) antibody (ABIN4345108) Immunohistochemistry: PGLYRP2/PGRP-L Antibody [NBP2-31930] - Immunohistochemical stai...
Immunohistochemistry (IHC) image for anti-Peptidoglycan Recognition Protein 2 (PGLYRP2) antibody (ABIN4345108) Immunohistochemistry: PGLYRP2/PGRP-L Antibody [NBP2-31930] - Immunohistochemical stai...