XRCC6 Antikörper

Produktnummer ABIN7882710

Dieser Maus Monoklonal Antikörper detektiert spezifisch XRCC6 in WB, IF, FACS und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für XRCC6 Antikörper (ABIN7882710)

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser XRCC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: 9B6

Produktdetails anti-XRCC6 Antikörper

Verwendungszweck: Ku70 Antibody

Sequenz: AIVEKLRFTY RSDSFENPVL QQHFRNLEAL ALD

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD were used as the immunogen for the Ku70 antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Ku70 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Ku70 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu XRCC6

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Andere Bezeichnung: Ku70

Hintergrund: XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.

UniProt: P12956

Pathways: DNA Reparatur