FZD7 Antikörper
-
- Target Alle FZD7 Antikörper anzeigen
- FZD7 (Frizzled Family Receptor 7 (FZD7))
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FZD7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- FZD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
- Top Product
- Discover our top product FZD7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FZD7 Blocking Peptide, catalog no. 33R-7010, is also available for use as a blocking control in assays to test for specificity of this FZD7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FZD7 (Frizzled Family Receptor 7 (FZD7))
- Andere Bezeichnung
- FZD7 (FZD7 Produkte)
- Synonyme
- FzE3 antikoerper, Fz-7 antikoerper, Xfz7 antikoerper, frizzled-7 antikoerper, frizzled7 antikoerper, frz-7 antikoerper, frz7 antikoerper, fz7 antikoerper, fzd7-a antikoerper, fzd7-b antikoerper, fze3 antikoerper, Fz7 antikoerper, cFz-7 antikoerper, fb38g02 antikoerper, fc44b09 antikoerper, fz13 antikoerper, fz7a antikoerper, fz7b antikoerper, wu:fb38g02 antikoerper, wu:fc44b09 antikoerper, zg13 antikoerper, frizzled class receptor 7 antikoerper, frizzled class receptor 7 L homeolog antikoerper, frizzled class receptor 7b antikoerper, FZD7 antikoerper, fzd7.L antikoerper, fzd7 antikoerper, Fzd7 antikoerper, fzd7b antikoerper
- Hintergrund
- FZD7 is 7-transmembrane domain protein that is receptor for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.
- Molekulargewicht
- 63 kDa (MW of target protein)
- Pathways
- WNT Signalweg, Stem Cell Maintenance
-