Sonic Hedgehog Antikörper

Produktnummer ABIN635696

Produktdetails anti-Sonic Hedgehog Antikörper

Target: Sonic Hedgehog (SHH)

Reaktivität: Human, Maus, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Sonic Hedgehog Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: Sonic Hedgehog antibody was raised using a synthetic peptide corresponding to a region with amino acids RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Sonic Hedgehog Blocking Peptide, catalog no. 33R-7837, is also available for use as a blocking control in assays to test for specificity of this Sonic Hedgehog antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Sonic Hedgehog

Target: Sonic Hedgehog (SHH)

Andere Bezeichnung: Sonic Hedgehog (SHH Produkte)

Synonyme: HHG1 antikoerper, HLP3 antikoerper, HPE3 antikoerper, MCOPCB5 antikoerper, SMMCI antikoerper, TPT antikoerper, TPTPS antikoerper, 9530036O11Rik antikoerper, Dsh antikoerper, Hhg1 antikoerper, Hx antikoerper, Hxl3 antikoerper, M100081 antikoerper, fc83d08 antikoerper, shh antikoerper, syu antikoerper, vhh-1 antikoerper, vhh1 antikoerper, wu:fc83d08 antikoerper, Xhh antikoerper, hedgehog antikoerper, xshh antikoerper, SHH antikoerper, twh antikoerper, twhh antikoerper, sonic hedgehog antikoerper, sonic hedgehog a antikoerper, sonic hedgehog L homeolog antikoerper, sonic hedgehog protein A antikoerper, sonic hedgehog b antikoerper, SHH antikoerper, Shh antikoerper, shha antikoerper, shh.L antikoerper, shh antikoerper, shhb antikoerper

Hintergrund: SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Hedgehog Signalweg, Dopaminergic Neurogenesis, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development