DHOdehase (N-Term) Antikörper

Details zu Produkt Nr. ABIN635074
Antigen
Epitop
N-Term
11
9
7
7
7
4
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Reaktivität
Human
73
29
27
17
12
11
9
9
8
7
4
4
4
4
1
1
Wirt
Kaninchen
68
5
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
Applikation
Western Blotting (WB)
69
38
29
9
6
1
1
Optionen
Immunogen DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids RFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLG
Spezifität DHODH antibody was raised against the N terminal of DHODH
Reinigung Affinity purified
Antigen
Andere Bezeichnung DHODH
Hintergrund DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
Molekulargewicht 42 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

DHODH Blocking Peptide, catalog no. 33R-7911, is also available for use as a blocking control in assays to test for specificity of this DHODH antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHODH antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-DHOdehase (N-Term) antibody (ABIN635074) DHODH antibody used at 1 ug/ml to detect target protein.