DHODH Antikörper (N-Term)

Produktnummer ABIN4886562

Produktdetails anti-DHODH Antikörper

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Bindungsspezifität: AA 132-173, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHODH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Dihydroorotate dehydrogenase (quinone), mitochondrial(DHODH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: RVFRLPEDQA VINRYGFNSH GLSVVEHRLR ARQQKQAKLT E

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Dihydroorotate dehydrogenase (quinone), mitochondrial(DHODH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: dihydroorotate dehydrogenase (quinone)
Protein Name: Dihydroorotate dehydrogenase (quinone), mitochondrial

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DHODH (132-173aa RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D), different from the related mouse sequence by four amino acids, and from the related rat sequence by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu DHODH

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Andere Bezeichnung: DHODH (DHODH Produkte)

Synonyme: DHOdehase antikoerper, POADS antikoerper, URA1 antikoerper, 2810417D19Rik antikoerper, AI834883 antikoerper, DDBDRAFT_0167009 antikoerper, DDBDRAFT_0185217 antikoerper, DDB_0167009 antikoerper, DDB_0185217 antikoerper, DHOD antikoerper, DHODase antikoerper, XFHB_12025 antikoerper, dhodh antikoerper, dihydroorotate dehydrogenase (quinone) antikoerper, dihydroorotate dehydrogenase antikoerper, dihydroorotate dehydrogenase (quinone) L homeolog antikoerper, DHODH antikoerper, Dhodh antikoerper, pyrD antikoerper, pyr4 antikoerper, Mrub_0263 antikoerper, Arnit_2124 antikoerper, Trad_2703 antikoerper, Ftrac_1484 antikoerper, Ndas_0799 antikoerper, Mesil_1876 antikoerper, Slip_0841 antikoerper, Spirs_1436 antikoerper, XFHB_RS12780 antikoerper, dhodh.L antikoerper

Hintergrund: Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

Synonyms: DHOdehase | Dhodh | POADS | URA1 | Q02127

Gen-ID: 1723

UniProt: Q02127

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus