DHODH Antikörper (AA 132-173)

Produktnummer ABIN5647841

Der Kaninchen Polyklonal anti-DHODH Antikörper (ABIN5647841) detektiert spezifisch DHODH in WB und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für DHODH Antikörper (AA 132-173) (ABIN5647841)

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHODH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-DHODH Antikörper

Bindungsspezifität: AA 132-173

Verwendungszweck: DHODH Antibody / Dihydroorotate dehydrogenase

Sequenz: RVFRLPEDQA VINRYGFNSH GLSVVEHRLR ARQQKQAKLT ED

Aufreinigung: Antigen affinity

Immunogen: Amino acids 132-173 (RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED) from the human protein were used as the immunogen for the DHODH antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Differences in protocols and secondary/substrate sensitivity may require the DHODH antibody to be titrated for optimal performance.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the DHODH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu DHODH

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Andere Bezeichnung: DHODH

Hintergrund: Dihydroorotate dehydrogenase is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

UniProt: Q02127

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus