Leptin Antikörper (Middle Region)

Produktnummer ABIN634796

Der Kaninchen Polyklonal anti-Leptin Antikörper wird verwendet zum Nachweis von Leptin in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für Leptin Antikörper (Middle Region) (ABIN634796)

Target: Leptin (LEP)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Leptin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Leptin Antikörper

Bindungsspezifität: Middle Region

Spezifität: Leptin antibody was raised against the middle region of LEP

Aufreinigung: Affinity purified

Immunogen: Leptin antibody was raised using the middle region of LEP corresponding to a region with amino acids LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Leptin Blocking Peptide, (ABIN940419), is also available for use as a blocking control in assays to test for specificity of this Leptin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Leptin

Target: Leptin (LEP)

Andere Bezeichnung: Leptin

Hintergrund: LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process