Leptin Antikörper (N-Term)
-
- Target Alle Leptin (LEP) Antikörper anzeigen
- Leptin (LEP)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Leptin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Leptin antibody was raised against the N terminal of LEP
- Aufreinigung
- Affinity purified
- Immunogen
- Leptin antibody was raised using the N terminal of LEP corresponding to a region with amino acids MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS
- Top Product
- Discover our top product LEP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Leptin Blocking Peptide, catalog no. 33R-6105, is also available for use as a blocking control in assays to test for specificity of this Leptin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Leptin (LEP)
- Andere Bezeichnung
- Leptin (LEP Produkte)
- Synonyme
- ob antikoerper, obese antikoerper, LEPD antikoerper, OB antikoerper, OBS antikoerper, leptin antikoerper, Lep antikoerper, LEP antikoerper, lep antikoerper
- Hintergrund
- LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake.
- Molekulargewicht
- 16 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process
-