Leptin Antikörper (N-Term)

Produktnummer ABIN634794

Dieses Anti-Leptin-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Leptin in WB. Geeignet für Human und Maus.

Kurzübersicht für Leptin Antikörper (N-Term) (ABIN634794)

Target: Leptin (LEP)

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Leptin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Leptin Antikörper

Bindungsspezifität: N-Term

Spezifität: Leptin antibody was raised against the N terminal of LEP

Aufreinigung: Affinity purified

Immunogen: Leptin antibody was raised using the N terminal of LEP corresponding to a region with amino acids MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Leptin Blocking Peptide, catalog no. 33R-6105, is also available for use as a blocking control in assays to test for specificity of this Leptin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Leptin

Target: Leptin (LEP)

Andere Bezeichnung: Leptin

Hintergrund: LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process