Glucagon Antikörper (Middle Region)
-
- Target Alle Glucagon (GCG) Antikörper anzeigen
- Glucagon (GCG)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Glucagon Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Glucagon antibody was raised against the middle region of GCG
- Aufreinigung
- Affinity purified
- Immunogen
- Glucagon antibody was raised using the middle region of GCG corresponding to a region with amino acids VSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMN
- Top Product
- Discover our top product GCG Primärantikörper
-
anti-Glucagon (GCG) (AA 119-148), (C-Term) antibody
GCG Reaktivität: Human WB, IF, IHC (p), FACS Wirt: Kaninchen Polyclonal RB19525 unconjugated
anti-Glucagon (GCG) (AA 21-180) antibodyGCG Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Glucagon (GCG) antibodyGCG Reaktivität: Human IHC, IF Wirt: Kaninchen Monoclonal unconjugated
anti-Glucagon (GCG) (AA 25-54), (N-Term) antibodyGCG Reaktivität: Human, Maus WB, IHC (p), FACS Wirt: Kaninchen Polyclonal RB19443 unconjugated
anti-Glucagon (GCG) (AA 1-180) antibodyGCG Reaktivität: Human ELISA, WB Wirt: Maus Monoclonal 1E2-E6 unconjugated
anti-Glucagon (GCG) antibodyGCG Reaktivität: Human, Ratte, Maus ELISA, WB, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Glucagon (GCG) (AA 53-81), (N-Term) antibodyGCG Reaktivität: Human, Ratte, Maus IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Glucagon (GCG) (AA 23-180) antibodyGCG Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Glucagon (GCG) (AA 53-81) antibodyGCG Reaktivität: Human, Ratte, Maus ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Glucagon (GCG) antibodyGCG Reaktivität: Human, Ratte, Maus ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Glucagon Blocking Peptide, catalog no. 33R-9829, is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Glucagon antibody is supplied as lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glucagon (GCG)
- Andere Bezeichnung
- Glucagon (GCG Produkte)
- Synonyme
- GLP1 antikoerper, GLP2 antikoerper, GRPP antikoerper, GLP-1 antikoerper, Glu antikoerper, PPG antikoerper, GCG antikoerper, gcg-A antikoerper, gcg1 antikoerper, glucagon antikoerper, glucagon L homeolog antikoerper, GCG antikoerper, Gcg antikoerper, gcg.L antikoerper
- Hintergrund
- GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis.
- Molekulargewicht
- 4 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Negative Regulation of intrinsic apoptotic Signaling
-
