Glucagon (GCG) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN634780
Antigen
Epitop
Middle Region
24
16
16
12
10
9
8
6
5
4
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
252
103
98
30
11
9
6
6
6
4
3
3
3
2
2
1
1
Wirt
Kaninchen
182
63
20
7
4
Klonalität
Polyklonal
Konjugat
Unkonjugiert
14
5
4
4
4
4
4
4
4
4
4
3
2
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
119
111
84
44
27
20
17
15
14
13
12
11
7
4
3
3
3
2
2
1
Optionen
Immunogen Glucagon antibody was raised using the middle region of GCG corresponding to a region with amino acids VSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMN
Spezifität Glucagon antibody was raised against the middle region of GCG
Reinigung Affinity purified
Antigen
Andere Bezeichnung Glucagon (GCG Antibody Abstract)
Hintergrund GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis.
Molekulargewicht 4 kDa (MW of target protein)
Pathways Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Negative Regulation of intrinsic apoptotic Signaling
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Glucagon Blocking Peptide, catalog no. 33R-9829, is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Glucagon antibody is supplied as lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCG antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Glucagon (GCG) (Middle Region) antibody (ABIN634780) Glucagon antibody used at 1 ug/ml to detect target protein.