Glucagon Antikörper (Middle Region)

Produktnummer ABIN634780

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Glucagon in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte und Maus.

Kurzübersicht für Glucagon Antikörper (Middle Region) (ABIN634780)

Target: Glucagon (GCG)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Glucagon Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Glucagon Antikörper

Bindungsspezifität: Middle Region

Spezifität: Glucagon antibody was raised against the middle region of GCG

Aufreinigung: Affinity purified

Immunogen: Glucagon antibody was raised using the middle region of GCG corresponding to a region with amino acids VSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Glucagon Blocking Peptide, (ABIN5613790), is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Glucagon antibody is supplied as lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Glucagon

Target: Glucagon (GCG)

Andere Bezeichnung: Glucagon

Hintergrund: GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis.

Molekulargewicht: 4 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Negative Regulation of intrinsic apoptotic Signaling