Connexin 43/GJA1 Antikörper (N-Term)

Produktnummer ABIN634661

Produktdetails anti-Connexin 43/GJA1 Antikörper

Target: Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Connexin 43/GJA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GJA1 antibody was raised against the N terminal of GJA1

Aufreinigung: Affinity purified

Immunogen: GJA1 antibody was raised using the N terminal of GJA1 corresponding to a region with amino acids LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJA1 Blocking Peptide, catalog no. 33R-5566, is also available for use as a blocking control in assays to test for specificity of this GJA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Connexin 43/GJA1

Target: Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))

Andere Bezeichnung: GJA1 (GJA1 Produkte)

Synonyme: AVSD3 antikoerper, CX43 antikoerper, DFNB38 antikoerper, GJAL antikoerper, HLHS1 antikoerper, HSS antikoerper, ODDD antikoerper, Cx43 antikoerper, AU042049 antikoerper, AW546267 antikoerper, Cnx43 antikoerper, Cx43alpha1 antikoerper, Gja-1 antikoerper, Npm1 antikoerper, connexin43 antikoerper, cx43a1 antikoerper, gja1 antikoerper, zfCx43.3 antikoerper, connexin 43 antikoerper, gja1-A antikoerper, cx43 antikoerper, gjal antikoerper, oddd antikoerper, dfnb38 antikoerper, gap junction protein alpha 1 antikoerper, gap junction protein, alpha 1 antikoerper, connexin 43 antikoerper, gap junction protein alpha 1 L homeolog antikoerper, CONNEXIN 43 protein antikoerper, GJA1 antikoerper, Gja1 antikoerper, cx43 antikoerper, gja1.L antikoerper, gja1 antikoerper, CONNEXIN 43 antikoerper

Hintergrund: Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: MAPK Signalweg, Myometrial Relaxation and Contraction, Cell-Cell Junction Organization