TLR5 Antikörper (N-Term)

Produktnummer ABIN634552

Produktdetails anti-TLR5 Antikörper

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TLR5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TLR5 antibody was raised against the N terminal of TLR5

Aufreinigung: Affinity purified

Immunogen: TLR5 antibody was raised using the N terminal of TLR5 corresponding to a region with amino acids QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TLR5 Blocking Peptide, catalog no. 33R-7642, is also available for use as a blocking control in assays to test for specificity of this TLR5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLR5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TLR5

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Andere Bezeichnung: TLR5 (TLR5 Produkte)

Synonyme: SLEB1 antikoerper, TIL3 antikoerper, TLR-5 antikoerper, sleb1 antikoerper, til3 antikoerper, tlr-5 antikoerper, tlr5 antikoerper, toll like receptor 5 antikoerper, toll-like receptor 5 antikoerper, toll like receptor 5 L homeolog antikoerper, toll-like receptor 5b antikoerper, TLR5 antikoerper, Tlr5 antikoerper, tlr5.L antikoerper, tlr-5 antikoerper, tlr5b antikoerper

Hintergrund: TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

Molekulargewicht: 98 kDa (MW of target protein)

Pathways: TLR Signalweg, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades