TLR5 Antikörper (N-Term)
-
- Target Alle TLR5 Antikörper anzeigen
- TLR5 (Toll-Like Receptor 5 (TLR5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TLR5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TLR5 antibody was raised against the N terminal of TLR5
- Aufreinigung
- Affinity purified
- Immunogen
- TLR5 antibody was raised using the N terminal of TLR5 corresponding to a region with amino acids QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
- Top Product
- Discover our top product TLR5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TLR5 Blocking Peptide, catalog no. 33R-7642, is also available for use as a blocking control in assays to test for specificity of this TLR5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLR5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TLR5 (Toll-Like Receptor 5 (TLR5))
- Andere Bezeichnung
- TLR5 (TLR5 Produkte)
- Hintergrund
- TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
- Molekulargewicht
- 98 kDa (MW of target protein)
- Pathways
- TLR Signalweg, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades
-