ALOX15 Antikörper (Middle Region)
-
- Target Alle ALOX15 Antikörper anzeigen
- ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALOX15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ALOX15 antibody was raised against the middle region of ALOX15
- Aufreinigung
- Affinity purified
- Immunogen
- ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL
- Top Product
- Discover our top product ALOX15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALOX15 Blocking Peptide, catalog no. 33R-7578, is also available for use as a blocking control in assays to test for specificity of this ALOX15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))
- Andere Bezeichnung
- ALOX15 (ALOX15 Produkte)
- Synonyme
- 15-LOX-1 antikoerper, 15LOX-1 antikoerper, ALOX15 antikoerper, 12-LO antikoerper, Alox12l antikoerper, L-12LO antikoerper, 12-LOX antikoerper, Alox12 antikoerper, ALOX12 antikoerper, 15-LOX antikoerper, Alox12e antikoerper, arachidonate 15-lipoxygenase antikoerper, Arachidonate 15-lipoxygenase antikoerper, ALOX15 antikoerper, Alox15 antikoerper, Nmul_A0532 antikoerper, Sden_1680 antikoerper, Swoo_2919 antikoerper, PCC8801_3106 antikoerper, Cyan8802_3014 antikoerper, Nwat_1315 antikoerper
- Hintergrund
- ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.
- Molekulargewicht
- 73 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-