ALOX15 Antikörper (Middle Region)

Produktnummer ABIN634401

Dieses Anti-ALOX15-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ALOX15 in WB. Geeignet für Human.

Kurzübersicht für ALOX15 Antikörper (Middle Region) (ABIN634401)

Target: ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALOX15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALOX15 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ALOX15 antibody was raised against the middle region of ALOX15

Aufreinigung: Affinity purified

Immunogen: ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALOX15 Blocking Peptide, (ABIN5612029), is also available for use as a blocking control in assays to test for specificity of this ALOX15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALOX15

Target: ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))

Andere Bezeichnung: ALOX15

Hintergrund: ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.

Molekulargewicht: 73 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization